Everything below concerns LC-MS/MS. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-09-26. Numbers and descriptions here follow the published literature rather than marketing material.
Storage conditions for research-grade SR9009 generally involve a freezer at approximately minus twenty degrees Celsius, sometimes lower for long-term preservation. Containers should remain tightly closed and protected from light. Desiccants may be used to limit moisture uptake. Solutions are often stored in aliquots to avoid repeated warming and cooling. Stability data for the compound under various conditions are limited, so laboratories typically follow supplier recommendations and verify performance through periodic analytical checks rather than assuming indefinite stability.
Identity and purity testing for SR9009 commonly uses liquid chromatography coupled with tandem mass spectrometry. This method separates the compound from matrix components and detects it by mass-to-charge transitions, providing sensitive and specific confirmation. Nuclear magnetic resonance spectroscopy can support structural identification, while high-performance liquid chromatography with ultraviolet detection may estimate purity. Because online products labeled as SR9009 may contain other substances or no active compound at all, independent verification is important in research settings. Certificates of analysis are useful but not a substitute for in-house testing.
Regulatory treatment of SR9009 varies by country and region. It is not approved as a pharmaceutical, and several jurisdictions restrict its sale for human consumption. Some authorities classify it as a research chemical, a prescription-only substance, or a prohibited performance-enhancing agent in sport. Purchasers may encounter certificates of analysis, but these documents do not guarantee identity, purity, or legality. In research settings, institutional safety reviews and controlled procurement help ensure that materials are handled under appropriate oversight. The absence of harmonized rules means that legal status can change and requires verification.
Analytical identification of SR9009 typically relies on liquid chromatography coupled with tandem mass spectrometry. In biological samples, researchers first separate the compound from matrix components using protein precipitation, liquid-liquid extraction, or solid-phase extraction. High-performance liquid chromatography with ultraviolet detection and nuclear magnetic resonance spectroscopy can support structural confirmation of reference materials. Because SR9009 is a small, relatively lipophilic molecule, reverse-phase columns and acidic mobile phases are common. Laboratories often include isotope-labeled internal standards to improve quantification and to correct for ion suppression.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Typical for research-grade material |
| Solubility | Soluble in DMSO and ethanol; low aqueous solubility | Organic stock solutions are common |
| Typical storage temperature | -20 °C or lower | Protect from light and moisture |
| Common analytical method | LC-MS/MS | Used for detection and confirmation |
| Common synonyms | SR9009; Stenabolic | Stenabolic is an informal name |
Laboratory studies often administer SR9009 by injection because oral absorption appears poor in rodents. Reported pharmacokinetic properties include rapid metabolism and low systemic exposure after oral dosing. Human pharmacokinetic data are sparse, so absorption, distribution, metabolism, and excretion in people are not well defined. Some research explores related REV-ERB compounds with improved drug-like properties. Regulatory approval for any REV-ERB agonist as a human medicine has not been granted to date.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ, also called NR1D1 and NR1D2. These receptors help regulate circadian rhythms and metabolic gene programs. The compound was developed for laboratory research, not as an approved therapeutic. Its identity is distinct from steroid hormones and selective androgen receptor modulators. Scientific interest centers on how REV-ERB activation changes gene expression in cells and animal models.
AAA (ATPases Associated with diverse cellular Activities) proteins (more commonly referred to as "triple-A ATPases") are a large group of protein family sharing a common conserved module of approximately 230 amino acid residues. This is a large, functionally diverse protein family belonging to the AAA+ protein superfamily of ring-shaped P-loop NTPases, which exert their activity through the energy-dependent remodeling or translocation of macromolecules. AAA proteins couple chemical energy provided by ATP hydrolysis to conformational changes which are transduced into mechanical force exerted on a macromolecular substrate. AAA proteins are functionally and organizationally diverse, and vary in activity, stability, and mechanism. Members of the AAA family are found in all organisms and they are essential for many cellular functions. They are involved in processes such as DNA replication, protein degradation, membrane fusion, microtubule severing, peroxisome biogenesis, signal transduction and the regulation of gene expression.
The American Society for Mass Spectrometry (ASMS) is a professional association based in the United States that supports the scientific field of mass spectrometry. As of 2018, the society had approximately 10,000 members primarily from the US, but also from around the world. The society holds a large annual meeting, typically in late May or early June as well as other topical conferences and workshops. The society publishes the Journal of the American Society for Mass Spectrometry.
The 5,10-methenyltetrahydromethanopterin hydrogenase (or Hmd), the so-called iron-sulfur cluster-free hydrogenase, is an enzyme found in methanogenic archea such as Methanothermobacter marburgensis. It was discovered and first characterized by the Thauer group at the Max Planck Institute in Marburg. Hydrogenases are enzymes that either reduce protons or oxidize molecular dihydrogen.
Azurin is a small, periplasmic, bacterial blue copper protein found in Pseudomonas, Bordetella, or Alcaligenes bacteria. Azurin moderates single-electron transfer between enzymes associated with the cytochrome chain by undergoing oxidation-reduction between Cu(I) and Cu(II). Each monomer of an azurin tetramer has a molecular weight of approximately 14kDa, contains a single copper atom, is intensively blue, and has a fluorescence emission band centered at 308 nm. Azurins and pseudoazurins participate in the denitrification processes in bacteria., including the gram-negative bacteria Pseudomonas aeruginosa, by interacting with cytochrome c551. Azurin from P aeruginosa is a type I blue copper protein (cupredoxin), while cytochrome c551 (9 kDa) is a haem-containing cytochrome. Azurin possesses a relatively large hydrophobic patch close to the active site, and two residues in this hydrophobic patch, Met-44 and Met-64, are believed to be involved in its interaction with the redox partners cytochrome c551 and nitrite reductase. Although unrelated to its electron-transfer property, azurin has been found to have anticancer properties through its interaction with tumor-suppressor protein p53.
Four members of 2A peptides family are frequently used in life science research. They are P2A, E2A, F2A, and T2A. F2A is derived from foot-and-mouth disease virus 18; E2A is derived from equine rhinitis A virus; P2A is derived from porcine teschovirus-1 2A; T2A is derived from thosea asigna virus 2A. The following table shows the sequences of four members of 2A peptides. Adding the optional linker “GSG” (Gly-Ser-Gly) on the N-terminal of a 2A peptide greatly helps with efficiency. 2A peptides trigger the ribosome to skip peptide bond formation between the glycine (G) and proline (P) near the C-terminus of the 2A peptide, resulting in the peptide located upstream of the 2A peptide having extra amino acids appended to its C-terminus while the protein downstream the 2A peptide will have an extra proline on its N-terminus. The exact molecular mechanism of 2A-peptide-mediated cleavage is still unknown. However, it is believed to involve ribosomal "skipping" of glycyl-prolyl peptide bond formation rather than true proteolytic cleavage.
Sources: en.wikipedia.org
Viral induction of apoptosis occurs when one or several cells of a living organism are infected with a virus, leading to cell death. Cell death in organisms is necessary for the normal development of cells and the cell cycle maturation. It is also important in maintaining the regular functions and activities of cells. Viruses can trigger apoptosis of infected cells via a range of mechanisms including:
Chromosome 11 open reading frame 91, or C11orf91 is a protein which in humans is encoded by the C11orf91 gene. The C11orf91 gene consists of 5159 nucleotides with an mRNA of approximately 836 base pairs. There is one exon found in the C11orf91 gene. The cytogenetic band location of C11orf91 is 11p13 and is located on the minus strand of the DNA . Annotated depiction of the C11orf91 mRNA and amino acid protein sequences. The C11orf91 gene encodes a protein that is 193 amino acids in length. The C11orf91 protein contains a domain of unknown function, DUF5529, that spans nearly the entire protein. RBMX protein binding sites were found to be highly conserved in several structures of human C11orf91 3'UTR and 5' UTR. C11orf91 is rich in serine and proline and poor in valine and asparagine. There is a proline rich region found in the middle of the C11orf91. The human C11orf91 protein is approximately 20 kDal and has an isoelectric point around 9. Human C11orf91 protein is predicted to be localized in vesicles. C11orf91 has two helices located near the C-terminus and no beta sheets.
It might occur either at the enzyme or receptor level. There are two possible outcomes at the enzyme level: competitive inhibition or enzyme activity reactivation. Ethyl alcohol or fomepizole used in methyl alcohol or ethylene glycol poisoning is a typical example of competitive enzyme inhibition. By posing competition for alcohol dehydrogenase (ADH) with methyl alcohol and ethylene glycol, these drugs reduce the production of harmful metabolites. For receptor level, the traditional antidotes include naloxone and flumazenil. Flumazenil functions as a competitive antagonist at the GABA-A receptor complex's benzodiazepine site. By doing this, the CNS and respiratory depression would reverse and the inward chloride current would reduce. Flumazenil is useful in treating and preventing benzodiazepine-induced coma from recurring.
Some of the oldest forms of biologics are extracted from the bodies of animals, and other humans especially. Important biologics include: Whole blood and other blood components Organ transplantation and tissue transplants Stem-cell therapy Antibodies for passive immunity (e.g., to treat a virus infection) Human reproductive cells Human breast milk Fecal microbiota Some biologics that were previously extracted from animals, such as insulin, are now more commonly produced by recombinant DNA. Biologics can refer to a wide range of biological products in medicine. However, in most cases, the term is used more restrictively for a class of therapeutics (either approved or in development) that are produced using biological processes involving recombinant DNA technology. These medications are usually one of three types:
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
Research-grade SR9009 is typically stored frozen at about minus twenty degrees Celsius, protected from light and moisture. Stock solutions are often kept in aliquots to avoid repeated freeze-thaw cycles. Specific storage conditions should follow the supplier's documentation.
Liquid chromatography with tandem mass spectrometry is widely used to detect and confirm SR9009 in laboratory samples. The technique offers high sensitivity and can distinguish the target compound from related substances. Nuclear magnetic resonance and ultraviolet detection may support identity and purity checks.
Online products labeled as SR9009 may vary in identity, purity, and actual content. Independent testing helps confirm that a sample matches its label and does not contain unexpected contaminants. This is important for reproducible research and for interpreting experimental results.
The most common approach is liquid chromatography-tandem mass spectrometry, often after extraction from blood, urine, or tissue. Ultraviolet detection and nuclear magnetic resonance spectroscopy are used mainly for reference material characterization. Isotope-labeled internal standards improve accuracy.